DPCstruct | MC36701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 78 ± 3 aa |
| Standard deviation of domain lengths | 3.38 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 57.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6R6W2 | 1-82 | YEALKPELGNYVKEIITSEGFISNLPPISGAIQSLRWLDEMPGVEVWICSTPLTAWTHCVPEKFEWVEKHLGKDLGWQRKGF |
| H3CPM7 | 1-75 | PQFQEKAISIWESKGFFMDLDPLPGGVEAVKEMAQMENTDVFICTSPIKHYKHCPYEKYAWVEKHLGHEFLEQVI |
| M7B7H0 | 2-75 | None |
| A0A833ZN37 | 7-88 | None |
| A0A672MAL9 | 40-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.