DPCstruct | MC3670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 101 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12008 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0MW71 | 9-117 | RSKKELIERFIAEHFANLSASADVGAEFDSYWEAQKQNALVTLSEDEGLKREALDKVLAHYLFTEKTPMRDDVIGIMEKRPPLRQRR… |
| A0A0B5DPB5 | 18-123 | AAYHSSLGASHDLPTITSAHQTTATFEEFWAEKREAAFQAIYIEERLDREGFAGLLEAYQFSSKRPLTDEVIAIMAEVPGILPREPS… |
| A0A5M9GLE2 | 7-107 | None |
| A0A3E0DY48 | 152-248 | None |
| A0A2X2T2J5 | 1-89 | None |
| A0A330GAM9 | 15-113 | None |
| A0A7T8M3P6 | 1111-1218 | None |
| A0A6S6TUU7 | 46-141 | None |
| A0A7Y6Z9L5 | 232-328 | None |
| A0A1J6X908 | 106-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.