DPCstruct | MC367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Standard deviation of domain lengths | 10.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0I8G2 | 10-103 | RVTSKQKVWDYIRRKGVFIVEDMMMVLDVKRDFLMPIFRALELSGYIELETGSDEFIDRRYRLLKNTGPKSPIILKKPCDIVKDKNT… |
| A0A660WTY8 | 6-102 | MQTDRAKIWKVIRAHKEEFTSADIEMLTDATYVNIKRYLKILADAGYLRKRRKPNLNGKGTHWVYRLVKNTGPKPPVQKDLRFLFDP… |
| A0A0N7Z4N2 | 92-180 | None |
| A0A0P4UYS6 | 1-84 | None |
| A0A285NJ98 | 158-271 | None |
| A0A807ZN88 | 67-170 | None |
| A0A2M8EEU8 | 21-134 | None |
| A0A0S3UEA9 | 112-213 | None |
| G2HX73 | 1-114 | None |
| A0A3M1YQH6 | 7-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.