DPCstruct | MC36698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 330 ± 46 aa |
| Standard deviation of domain lengths | 45.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4CSX8 | 148-467 | QTPAVAIGQPMCLSEPVSTCRIQCCKHHRVSSDGDVQPQGTEMLESVGRTPAMRAIDPQVGAYYIPLTHLVETAGSRSGLSGERDPS… |
| W6LBT8 | 11-267 | TMVDLHAHQNPQHDASKEISLSEGNLNEARFDTPLILCQDFLSLRGCAHGSGCEKVHVAGMEYMWCPIEPSTLVKDGKEMYKPGFRI… |
| A0A0S4JNL5 | 156-541 | None |
| A0A0S4JPI5 | 14-348 | None |
| A0A0S4JWC5 | 111-417 | None |
| A0A7S1MSZ6 | 31-339 | None |
| A0A7S1W6X4 | 2-303 | None |
| A0A7S1W728 | 91-417 | None |
| A0A3R7LMF9 | 30-386 | None |
| A0A7G2C3L6 | 98-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.