DPCstruct | MC36696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 148 ± 10 aa |
| Standard deviation of domain lengths | 9.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7FQC6 | 1-145 | MTPNNEVRRDVDPQETREWLESIESVLSTEGRPRAHYLIDQLLDFDVARHGDFYGRVTTPYVNTIPVERQLPYPGNLVIERRINAFI… |
| A0A1J1EM75 | 24-158 | AENREWLESLEYVLKVEGPERVEELLRLLDEYLFRHGVYPANRLSTPYLNTLPKEKEPPYPGDLELERRIANILRWNVAMMVTRANK… |
| A0A1A9Z120 | 2-147 | None |
| A0A3E0PRJ3 | 17-159 | None |
| A0A1F9N679 | 1-175 | None |
| A0A5E6NXT2 | 2-143 | None |
| A0A6H2FPK2 | 1-151 | None |
| A0A447QCH5 | 1-150 | None |
| A0A1H5NW03 | 17-157 | None |
| A0A7V7MTX8 | 2-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.