DPCstruct | MC36695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 101 ± 5 aa |
| Standard deviation of domain lengths | 5.20 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840DCG3 | 58-163 | QVYGSALPVAYSAAPAELWAPFAKLVLEAAYEATLRAGIQNGKRSGGWTTYLTLLGGGAFGNRPEWIIGAIRRALNACRECLLEWPL… |
| A0A7W8CHB9 | 1-93 | MTRSSWEAIARLVLEASYEATLLSAVEQSVAGGSNVVLLTRVGGGVFGNTDAWIDDAIVRALGIVEHAGLDVRLVSFGSVHPSFRAI… |
| A0A7S2HIE1 | 17-107 | None |
| A0A5C5YK66 | 159-262 | None |
| A0A7J6RNB8 | 572-671 | None |
| A0A7S2FQ41 | 54-157 | None |
| A0A7S1HYA7 | 29-132 | None |
| A0A2H4TY50 | 128-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.