DPCstruct | MC36693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 205 ± 26 aa |
| Standard deviation of domain lengths | 26.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8UGM0 | 44-281 | PTVAETKAKFFEGYSKPIASIYSTVLQELLVQQHFMRYSKDYVYNEIFALGFVSVYEQILESLPQSERDAIFVSYVKALGEDPEAYK… |
| H6WBA6 | 21-232 | GKDVKTVSETIKSFCIQYQKPILPQYRTMINDVLQSTHLNVVNGCFIYDAMFGYGFYSLFYKLMKAYPGTGEADLIYAAMVTSLDME… |
| A0A812RYJ1 | 18-174 | None |
| A0A2I0X1F9 | 5-169 | None |
| C1N362 | 4-203 | None |
| B7FIT6 | 21-218 | None |
| A0A7S3UFW7 | 1-176 | None |
| R1CKP5 | 43-262 | None |
| R1BNA2 | 1-206 | None |
| S0F2S3 | 2-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.