DPCstruct | MC36689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 275 ± 22 aa |
| Standard deviation of domain lengths | 21.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 53.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834Z3L0 | 781-997 | IKRRRKRNKTATDSVETALEEDAPGLLQVLIDKGITVDEIKLYGDMENDDALDISSIEDGFAELEAVISKTRYLQFRKWPVEWGWCR… |
| A0A7S1T0Z5 | 1-303 | MEWKRQQGPVTLAQALHEDAPGLVPELQTAGLLNDMPLLDVELSEAEGYGLLHTMLREVCDAVPARARSAAPVLSNPLLDAAKKSKR… |
| A0A4Y7JP44 | 247-544 | None |
| A0A061RYB6 | 14-300 | None |
| A0A2R6R643 | 125-411 | None |
| A0A1D6PGT1 | 1-275 | None |
| A0A835HJC6 | 230-518 | None |
| A0A453ILW4 | 347-606 | None |
| A0A1D1XJW9 | 611-873 | None |
| A0A804JFK8 | 870-1148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.