DPCstruct | MC36686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 179 ± 42 aa |
| Standard deviation of domain lengths | 42.17 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04720 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8F435 | 1-128 | MDFKRRLMSRLRDRGFDVGICKSKWERNGHVPCGNYEYIDVNMIENRYIIEINLAREFEIAWPTTCYTSLLEIFPSIYVGKVDELKQ… |
| A0A7S1SQA7 | 40-223 | TQAALATAFDVFGKAPYTKQLRHDVDEALRVDTEASKANSHLDRLSAALASRGHLATAHVSPAVCVDTPGSQFQVGLKHSFITCTPP… |
| A0A6V7NPQ3 | 154-326 | None |
| A0A830CMC4 | 2-139 | None |
| A8J998 | 29-186 | None |
| A8J2T1 | 221-357 | None |
| A8J1L2 | 2-203 | None |
| A0A5B8MEL5 | 47-229 | None |
| A9TR24 | 35-224 | None |
| A0A7J9K6U4 | 2-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.