DPCstruct | MC36683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 111 ± 8 aa |
| Standard deviation of domain lengths | 8.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9IYT5 | 101-201 | ATVPYQYPNNGMFVREYTIKLLSTSFPNMTATEVTQLVNGLFESRNDLSTFKNHIRDFLVQSKEFSAQDNKDLYAEEAALQRERERQ… |
| A0A6U1ELA1 | 21-124 | PNAYPDNASYVREQLINLLSTSFPNLTPGQVQACVTGMFDLKDHSMFKDHLRDFLVQTKQFASQDNAELYAEEVAARAAAERQRLDT… |
| A0A6A4V980 | 26-145 | None |
| A0A183M4M3 | 61-174 | None |
| A0A7S2SWA8 | 215-336 | None |
| A0A117NLF6 | 20-123 | None |
| A0A7S1GGX2 | 100-214 | None |
| A0A0S7KU37 | 237-355 | None |
| A0A0A9LJR3 | 1-97 | None |
| A0A2S2NE54 | 384-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.