DPCstruct | MC36680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 138 ± 26 aa |
| Standard deviation of domain lengths | 26.21 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.96 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0441- PF03691 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1AIA1 | 89-227 | YQGPFYSEDQVEGICPWCIKDGSAAKKYDGEFQDAASCEDVEKEEYLVELTTRTPGYSGWQQERWLSHCGDFCALKGYVGWQEIKPL… |
| A0A4R2BIN3 | 29-183 | CNRPAGLKYTGPVYGRQPEVLCLRCIADGTAAVSLGLPDGSQAEFTDVGWGVPDDVPKAVLEEISQRTPGFISWQQEHWLYHCADAA… |
| A0A1E4J059 | 19-165 | None |
| A0A7W1GWK4 | 42-198 | None |
| A0A368VG31 | 18-190 | None |
| A0A2V1K285 | 5-172 | None |
| A0A1Q3GL16 | 112-212 | None |
| A0A418MGU5 | 204-394 | None |
| A0A2T1A0G9 | 7-141 | None |
| A0A4Y6Q0M2 | 262-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.