DPCstruct | MC36674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 461 ± 122 aa |
| Standard deviation of domain lengths | 121.83 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 24.62 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0286- CL0363 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257PHG2 | 183-735 | SVAGDLVIATATNASGSNVDIFGAVAVAGHVVVGGGGAADLVVAGSLAAAVISIASAGSMAVIGAARVSTAALNDAGVLNISDQAHL… |
| A0A1M3Q885 | 224-674 | FAPVAGGGFITAGYQPVGSYNSSAGTYPGFTLQVQQISTGGAISTVDTVTGIAGGVQTRSVNWIDTVGDGTVHFLESGSTTTADIYN… |
| A0A840VNS9 | 545-990 | None |
| A0A257QYZ8 | 432-984 | None |
| A0A257QQT1 | 2-286 | None |
| A0A252C144 | 17-337 | None |
| A0A4Y6UGD9 | 254-923 | None |
| A0A2S6NCT7 | 81-589 | None |
| A0A4Y6V703 | 118-619 | None |
| A0A2S9Q5D3 | 7-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.