DPCstruct | MC36672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 42.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484Y4G5 | 1-58 | MPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELARSGANYQNQNS |
| J6I3S0 | 62-125 | IPPIFSNHFAHRLNAISKLTVKEAEDGEAIKDSTAYIAPGGQHMKLERRSGRLIVTCTKGDPVN |
| A0A2D8SV01 | 83-146 | None |
| A0A090T398 | 74-130 | None |
| A0A2E3XV42 | 903-960 | None |
| A0A098LMB1 | 139-204 | None |
| A0A1I7XZH9 | 1-55 | None |
| A0A0N0I7C9 | 120-183 | None |
| M4V7Q2 | 286-351 | None |
| A0A1G2ZCC0 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.