DPCstruct | MC36671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 115 ± 16 aa |
| Standard deviation of domain lengths | 15.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 93.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.14 |
| Pfam Score | 94.77 |
| Assigned Pfam label(s) | PF02092- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484XRG2 | 111-229 | VDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALETPLPLPAYERILKAAHSFNLLDARKA… |
| A0A7Z6SQF7 | 3-96 | EYQFSKYHFEIASVTRLLEMFKNAQAEALHCLENKLPLPAYDFVMLCSHFFNILDARKAISVAERQNYILQIRDLAKGCAILYKEQE… |
| A0A7C4RXU0 | 9-113 | None |
| A0A3M1YL79 | 132-242 | None |
| A0A7Y5VK25 | 56-190 | None |
| Q3JVV8 | 227-357 | None |
| A0A1D6NXM7 | 225-382 | None |
| A0A6N2NG88 | 133-267 | None |
| A0A1G5C4T2 | 560-679 | None |
| A0A3M3E554 | 408-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.