DPCstruct | MC36670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818CPF0 | 265-333 | LIDAYAGALGGLACKSPIADAHLSERLIIVAGTSSCFMACSEKAVFVPGVWGPHYNVLIPNLWLSEGGQ |
| A0A812MXB7 | 554-640 | IIDAHAGGIGMIGAALEGVSPSASDLERRLALIGGTSSCHMAVSAEPRFIQGIWGPYYSAMIPGMWLTEGGQSATGALIDFVIQNHG |
| A0A5J4Z5W4 | 303-370 | None |
| A0A6A3BBR9 | 507-577 | None |
| A0A813MDW5 | 432-500 | None |
| A0A7S2TGQ2 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.