DPCstruct | MC3667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 177 ± 25 aa |
| Standard deviation of domain lengths | 25.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0571 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D3D5V1 | 10-168 | FRLIYDNPILASFQEKRFCTMLNMGMIQIGVKTLTTKIPSNASIILCVFDTRNDNFEDSILGLVEAKLSDGPMFFNIFPNITMSLFH… |
| A0A5A7UGF0 | 1-193 | MKDEFTAIKLLPEETLFRVKEKFKYLHIRCVQVALKPLFREGLDVPVYLALRDKRHLRFTHSLLGIVQSNLEQGPVYFNCRPNLTVS… |
| A0A1R3I3H2 | 38-234 | None |
| A0A2G3BE08 | 695-883 | None |
| A0A0A0M024 | 86-245 | None |
| A0A2U1QD00 | 16-215 | None |
| A0A151TE17 | 2-213 | None |
| U5DEY8 | 280-521 | None |
| A0A5A7TFE5 | 14-150 | None |
| A0A7J6EQS9 | 4-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.