DPCstruct | MC36668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 223 ± 29 aa |
| Standard deviation of domain lengths | 28.61 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484VVU6 | 3-209 | CYLGALSSPWLLGLTGGWYLITRPLVSGMLVGIILGDIKTGIMIGVAVQAVYIAMVTPGGSMPADLNFVAYPAIALGILSGKGPEVA… |
| A0A7V2AV50 | 27-253 | SMGAYLAVSLIGGAMALENRSSLRLMLSQPICSGPIIGLALGSPSDGLLAGLMFQVMFLGYVRLRGGRQPDIPLGGAAAAALYILSL… |
| H3NMD8 | 74-298 | None |
| A0A1Y3TSI3 | 88-328 | None |
| A0A2V7ED61 | 157-378 | None |
| A0A381KLD0 | 295-523 | None |
| A0A7C7Q8E0 | 41-291 | None |
| S4G260 | 339-579 | None |
| A0A2H6GMB0 | 1-228 | None |
| A0A0J9B8P9 | 2-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.