DPCstruct | MC36661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 90 ± 12 aa |
| Standard deviation of domain lengths | 12.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9RC79 | 9-90 | EVKIRPIRKEEFSLWKELMNKYHYLGYKRMPGKNTHYVATLRDRWVALLGWDSAALKCKVRDEFIGWDKKKRLEGCKSTFKG |
| A4BR39 | 9-101 | ASILSDFIVRPVERHEESRYQAQMAAHHYLGALPKIGETLWYVATWRGRWLAQIGLSAAALKCGVRDDWIGWGFRTQLDRLKLIANN… |
| Q1Q2Y2 | 2-75 | None |
| A0A1H0VQP3 | 2-68 | None |
| A0A3A4YX53 | 64-166 | None |
| A0A1V1P069 | 13-105 | None |
| A0A7C1VXA1 | 7-90 | None |
| A0A7Y0L3C2 | 16-93 | None |
| A0A1E7XQV9 | 100-195 | None |
| A0A6C1PDG7 | 619-716 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.