DPCstruct | MC3666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 94 ± 17 aa |
| Standard deviation of domain lengths | 16.81 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.37 |
| Pfam Score | 99.32 |
| Assigned Pfam label(s) | CL0229- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0MXY3 | 1-76 | MSENQFYENGCGNCSFLQMDGDHRRILDCTSSNFNGFISIIDPQKSWSARYNNLNDLIPGCYAISVNGTLPESIKD |
| A0A5A7U4T8 | 8-99 | IPTSFGHELRACLRCRLVKTYDQFRESGCENCPFFKMDEDHERVVECTTPNFNGIISVMDPARSWAARWLRIGRFVPGCYTLAVSEA… |
| K8ENM3 | 10-111 | None |
| B0EL08 | 71-161 | None |
| A0A814RMJ2 | 659-815 | None |
| A0A7J6UKX2 | 108-204 | None |
| A0A7J6UAM9 | 234-325 | None |
| A0A194RH31 | 4-108 | None |
| A0A2I2YD21 | 1-59 | None |
| A0A5B8MJR3 | 88-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.