DPCstruct | MC36654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 237 |
|---|---|
| Mean domain length (aa) | 102 ± 19 aa |
| Standard deviation of domain lengths | 19.05 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.31 |
| Pfam Score | 99.33 |
| Assigned Pfam label(s) | CL0044- CL0232 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4AXA0 | 8-100 | MSRESDVLSEVKKAVSNVVDPEIGLTLGELNLVKDVRREDGKIVVEFVATTPFCPLAEILALMVKDAANAAVKDEKILVYIRKHINE… |
| A0A650CPN9 | 6-76 | LSEVLEPETGVPVVELGLVREGEDGTLYYKPISPYTPQILVIALGIELVLYTRRRVKLENYYLEEEINKRL |
| A0A535AGD8 | 196-293 | None |
| A0A7S2UKE7 | 124-264 | None |
| F4Q5Z3 | 5-152 | None |
| A0A7S4A4W0 | 27-167 | None |
| A0A4Y7L1S6 | 387-506 | None |
| A0A835Y1N3 | 311-396 | None |
| J2STQ6 | 179-287 | None |
| A0A662ULM3 | 4-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.