DPCstruct | MC36652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2YVC7 | 3-109 | TKKQLINIKTKAIRAGVWFKVLQRIDRVLFDLTIRVVETIRSSELANAILMLSHKLDNAAKSHFSNRLNIIGRSLAEKVGIVAQKLG… |
| A0A7J3GC57 | 6-100 | WFNVLSRLERGLVDFVIKAIDRPRSPKLIEVLARIIVKIKKSMISPVRRLMEQVGKPLAKKISAIALKWGNKSAAEWAEDKGFIKYL… |
| A0A3D5KMP6 | 2-83 | None |
| A0A7J2YZC2 | 2-104 | None |
| A0A7J2YX98 | 35-152 | None |
| A0A497P5H5 | 26-148 | None |
| A0A842MVB4 | 46-167 | None |
| A0A533WKU4 | 2-106 | None |
| A0A7J3A8Q1 | 34-147 | None |
| A0A842N3K1 | 18-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.