DPCstruct | MC36651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 121 ± 24 aa |
| Standard deviation of domain lengths | 24.19 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3WY08 | 84-205 | KLKNPTLDELQNFLAMDDVNTHEYIEYVYDCQSFSRDLRVNAKSKGYNLSYITVDFYAKLYIFGYEITLERAHALNGAYLADGRWVW… |
| A0A496A2B0 | 48-138 | GVSLETWQLILAYNGTDKKRYVKDTFDCDNFAILFAGSVADKFSINGAGIVIDYSGGHAYSALLVATENGLAFATIEPQNDQFVIKM… |
| A0A076IAC0 | 139-294 | None |
| A0A7C0U3L1 | 6-192 | None |
| A0A497AN62 | 5-99 | None |
| A0A3C1DM64 | 130-264 | None |
| A0A7V3SAR5 | 105-204 | None |
| H8I686 | 217-349 | None |
| A0A497I4M1 | 98-204 | None |
| A0A7V3JSJ7 | 7-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.