DPCstruct | MC3665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 130 ± 19 aa |
| Standard deviation of domain lengths | 18.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 35.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7TVS3 | 20-141 | ERNYDDDEKRRPTLKERQKKVYPFSDFDVADMLKQLIKNQLIQLPECKRPEQAGKVDDPNYCKYHWVISHPVEKCFVLKELILKLAR… |
| A0A2K1WU37 | 38-137 | RNDRATPSTFQKGERKKPSLKERQEKVYPFPDSDISRMLDDLLEANIIELPEVKCPDEANQMDNPNYCKYHRLISHPVEKCFVLKDK… |
| A0A5A7TM63 | 57-166 | None |
| A0A5D3DWV0 | 88-189 | None |
| A0A834LWB1 | 282-414 | None |
| A0A5A7VFA5 | 121-243 | None |
| A0A5A7VNX1 | 56-192 | None |
| A0A5D3CZ90 | 1-136 | None |
| A0A445C5Y4 | 84-205 | None |
| A0A6V7NP55 | 81-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.