DPCstruct | MC36648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 186 ± 33 aa |
| Standard deviation of domain lengths | 33.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.36 |
| Pfam Score | 54.08 |
| Assigned Pfam label(s) | PF00384- CL0486- PF10588- CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4WBF5 | 1-170 | CHLQDMTAMCGHVYRRFRFKKRTYKNQYLGPFVTHEMNRCIQCYRCVRFYRDLAGGRDFNYFGSRNRVYFGRDRDGVLESEFSGNLV… |
| A0A4Y9ZC50 | 151-311 | QDQSMRYGSDRSRFHEITGKRAVENKDLGPLVKTSMNRCIQCTRCVRFANEVAGVEELGTTGRGNDLQIGMYVEKTMDSELSGNVID… |
| A0A565C609 | 179-385 | None |
| A0A538MJ71 | 224-432 | None |
| G7V5S0 | 578-746 | None |
| A0A7E4SG70 | 149-334 | None |
| A0A3C0IN28 | 21-185 | None |
| A0A847DGD2 | 609-783 | None |
| A0A840UX01 | 107-342 | None |
| A0A7C1IWD4 | 92-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.