DPCstruct | MC36647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 86 ± 4 aa |
| Standard deviation of domain lengths | 4.32 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 36.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8FHZ6 | 1-86 | MVIGLIFITYGYFLKLVIADRAAIVVNGVFNSIESYSSLVLFFAAFLFTIQIYCDFYSYSIIAKGSAKILGVDLMDNFKEPFFQNL |
| A0A825L175 | 7-90 | LIIILLIFGIVKKVLIANYLGIYAKNILDFPQSYNFIQLLSAIYAYAVQIYCDFSGYVDLVCAFALMLGFTLPPNFNMPYLAKN |
| A0A6M0ASN3 | 10-94 | None |
| A0A7U9XB06 | 150-237 | None |
| A0A7C3Z4E6 | 2-96 | None |
| N1UJG6 | 9-89 | None |
| A0A3E2TQI2 | 213-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.