DPCstruct | MC36642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 133 ± 8 aa |
| Standard deviation of domain lengths | 8.07 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 17.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9HVZ7 | 1-120 | MGDAIGQNAFGVKVRYSRTSVTSLLLAMPSDKAQAFQEGITFQTNKSKAAQIIGQASMAISGRLLYPFIAHQFDYKKPTIDSPSKIY… |
| A0A6I2SNZ7 | 168-296 | RESKVYKDEYIGTNAYGVNVNVKKYTTEKIVLVVNNSEPYEIDNSLFKKKIKITIKDVSVETAKHNKNSIAAICVFKIKSPFVGKDG… |
| A0A2W6S218 | 99-237 | None |
| A0A4R2WSB7 | 1-141 | None |
| A0A524BEB0 | 56-184 | None |
| A0A433CUP3 | 144-275 | None |
| A0A369VT84 | 82-200 | None |
| A0A2N2KDX5 | 164-301 | None |
| A0A0W1ICD6 | 91-227 | None |
| A0A1G9S707 | 180-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.