DPCstruct | MC36641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 195 |
|---|---|
| Mean domain length (aa) | 123 ± 16 aa |
| Standard deviation of domain lengths | 15.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.27 |
| Pfam Score | 95.72 |
| Assigned Pfam label(s) | CL0023- PF05090- PF04134- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8ZBU4 | 3-122 | ETKRIEVYTDGRCPLCQWTRARVEPWDAQRRIEWFDYNEPESLTRAAPHTLAELGDEMHVRLEDGGWRRGYEAWLEVVGVLPRWSWL… |
| A0A2T4WKX3 | 9-124 | PKALLIWDGECEFCAFWISYWQQKSGPEIEYKTFQNAAADFPDINKREFLLASHFIEPDGGVYRAARSAYRSLYYTGRLKFLDRMYL… |
| C6XN73 | 2-121 | None |
| A0A1R3JZ48 | 2-141 | None |
| A0A7S3G6X9 | 52-180 | None |
| F4Q3X9 | 30-164 | None |
| A0A453DCA2 | 2-107 | None |
| A0A0X8HC71 | 6-124 | None |
| A0A2N9HYY3 | 363-486 | None |
| A0A5C4T145 | 4-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.