DPCstruct | MC3664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 117 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7RPZ2 | 75-194 | SLKRLERERYVILYVKAKNGIREFVKMAGFEYRLGNAYYEHTKSETISQKKRIILQDKASGSIYESPAAREMVGLGKGMQDWNIQPG… |
| A0A250K1B5 | 124-238 | GRFQVLDVDKAQPIKDFVQEHGLRFKTGRGFYAFTKTETIQGGKEVVLMDRKTGDLYSGERARELLGLPPGETVRIRPASLEKYAVF… |
| A0A812M134 | 3-117 | None |
| A0A2P6P043 | 62-173 | None |
| A0A1Z1WSF1 | 6-118 | None |
| K1PLD7 | 20-135 | None |
| A0A2P6N1D3 | 3-115 | None |
| A0A0M9FY10 | 2-145 | None |
| A0A6P4Z739 | 3-124 | None |
| A0A1S3J4C1 | 5-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.