DPCstruct | MC36638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 124 ± 19 aa |
| Standard deviation of domain lengths | 19.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1RWS0 | 10-148 | IALCLINTSFATSKWPLPMDIKQIGNAPAACLPKDDKESIEVKAAYVYESYAPVETQTRWLIEMKPSTKPLVLHPGECLAYGKNIDG… |
| A0A7V1N7D5 | 71-148 | ITVGTGTTPTYSWDGGPVMALTVNYTSDPENPVWGIVTPNEDGIESPVTHGTVPDGAIETFSEELELVAGEEYEVSVF |
| A0A1C4CK28 | 2-104 | None |
| A0A7X7D449 | 41-141 | None |
| A0A6N6Q8Q6 | 1-83 | None |
| Q63TC5 | 34-169 | None |
| A0A3A8EI03 | 2-135 | None |
| A0A378TTR3 | 3-124 | None |
| A0A6G3BH91 | 3-134 | None |
| A0A2T7B9S5 | 8-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.