DPCstruct | MC36637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 212 ± 16 aa |
| Standard deviation of domain lengths | 15.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V7GC40 | 2-192 | QGFGDELSALAEHYRKMTERQEAFDAEIARRQFNGRIALAEDELAAKAPADGAGMHEAMYGQLDPYDGRAVKPGLFEKMFGEVLPSM… |
| A0A8B3L4P5 | 32-223 | MQQFGDRWQAAAERYEQRKAQQQAFDTEIAARRLNGELAKAEADAVANAPADGAGLHEAMYGQVDPYTGQVVKTGLFDTLFGNFLKQ… |
| A0A378AE62 | 1-236 | None |
| A0A4R9RY49 | 3-197 | None |
| X5YR70 | 1-226 | None |
| A0A5C1WEK1 | 1-194 | None |
| A0A212DJA8 | 1-218 | None |
| X6GPF7 | 164-385 | None |
| A0A0K2VYM7 | 1-226 | None |
| M5FFB9 | 1-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.