DPCstruct | MC36634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 324 |
|---|---|
| Mean domain length (aa) | 125 ± 21 aa |
| Standard deviation of domain lengths | 20.58 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380Q3H2 | 3-98 | VQKASNDLHGLRFHDYGKTARAEGQYLFETFTPQINRNGLALPPDWNGMTGIKQWQITPNTTIIRGRAAPQFEYGSQYSGGADQIFV… |
| A0A3R6RJE5 | 20-128 | PRVYRKQILESFNVETIKLQTAGDSTYGLRFYGGNANTEGRYLFETFSPLTNRQNLALPYEWNRMTGIQQFQVRSGTIMITGKTAAQ… |
| A0A521GMW9 | 8-100 | None |
| A0A521GMU6 | 107-243 | None |
| A0A3M0Y6J3 | 281-397 | None |
| A0A378RM51 | 42-204 | None |
| A0A7K1L5Y1 | 476-577 | None |
| A0A419HMQ1 | 812-932 | None |
| A0A419HCW3 | 545-649 | None |
| A0A1Y3TH61 | 385-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.