DPCstruct | MC36633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 254 ± 33 aa |
| Standard deviation of domain lengths | 32.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6QSC8 | 55-295 | VEGLEEVKEVDPFEDIEVTFSGTPPYVYPDWTNNSDDDYLRYLWFNFEDYDSLDVGDTVTLTVDESEENALANGYKFTQTSKEYTVS… |
| A0A352WFR1 | 259-544 | DYISGSLNKDSALTNGDTIKYKWDVDKTKIEKLFKVKVKCSTVEHKVSGLKKVKTKDIKKDLNIKFEGEDGEGYAYFDSDKEYGIYF… |
| U2SKN4 | 47-306 | None |
| A0A837IMW6 | 2-219 | None |
| A0A2P1G4G0 | 104-360 | None |
| E7FXQ6 | 180-446 | None |
| A0A5R8QFE5 | 142-409 | None |
| A0A251WQW1 | 305-554 | None |
| A0A3B9FZN8 | 106-408 | None |
| R6UJQ9 | 79-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.