DPCstruct | MC36627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 102 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3LKM7 | 78-180 | PLGYNIHLEHHAVKRWNERVCTPVLPEQLQVLLQQIYYMGRIKISRDGWGFIDQDILFGYRWKKNTLIIQTFLGRTSLVPHLANYPS… |
| A0A1K1NYY7 | 1-107 | MSESEAAKEALVAAITDHAYDQYCSRVEKVSRGDLVALVQQQLDDLDYDYRKKSFIHLAGIWWVYTIEDNRFVMVTCYGRSDWNVPH… |
| A0A831TSU6 | 1-86 | None |
| A0A831TGN2 | 1-99 | None |
| A0A2N0ZMZ3 | 19-113 | None |
| A0A1C0YAV9 | 50-151 | None |
| A0A1I1SAP4 | 54-152 | None |
| A0A2M9Q5P8 | 52-157 | None |
| A0A2S8NW84 | 35-146 | None |
| A0A845QZ24 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.