DPCstruct | MC36626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 132 ± 14 aa |
| Standard deviation of domain lengths | 13.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5CAN0 | 1-104 | MTDAQRTKLTQDHHLAPLKPIELATPDQLQDALDDCTLDHWSSKTQALSSRFDAARHAALLLLKPNVMLVSITKRTLNNEAELKAWL… |
| A0A8B5X0Z5 | 16-144 | EYASRHAEGLKRLADDSHWRQLEPEQRYPLMSAQFLHESARPKVEVQSTRDVLTTLDHCALSMFADRVAAMPARFDNVASAAAELCE… |
| A0A091AGY3 | 100-203 | None |
| A0A1V6GQK7 | 472-613 | None |
| A0A838FJX8 | 24-162 | None |
| A0A1E4PRH8 | 313-450 | None |
| A0A1Q8YCP6 | 185-322 | None |
| A0A370AP64 | 114-255 | None |
| A0A3M7LFZ1 | 10-130 | None |
| A0A4P5WXH8 | 1022-1161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.