DPCstruct | MC36624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 175 ± 10 aa |
| Standard deviation of domain lengths | 10.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517VD11 | 6-174 | LIFRFSQIFWGLFIVMLDFSFNGFDLLPDGIGYLLMAAGCYGLASLSPRFLMAQTLCLILALLWLIHFAIDGSSAILFNFVRQVTNC… |
| A0A1G5L8C2 | 2-174 | VFNRLFWGFLFILFDFRLQGFNVLPDIVGYIIIFSTLARLIEDSPHFERARKYAFPLIFLSILDIYEAPTNGININLGGSSLIVVIS… |
| W4QXF8 | 4-192 | None |
| A0A226BZB5 | 2-177 | None |
| A0A2S8FQP4 | 23-217 | None |
| J0NBJ5 | 25-195 | None |
| A0A3A5HEI8 | 2-161 | None |
| V9H6Y8 | 1-178 | None |
| A0A7Y9RWL1 | 22-183 | None |
| A0A3S1BPS1 | 2-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.