DPCstruct | MC36622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 148 ± 27 aa |
| Standard deviation of domain lengths | 27.00 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 16.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5R800 | 55-140 | WEAHAAHTRPANNREKIVVAAAHLAEVGEEPTPGRVFDLFADAGWKVPVRPEDTLQQTAAAGWIGLEDGAVTVTDAGERLIDALPR |
| A0A7X0LIP4 | 9-154 | TFSVTVAGAGISIQREVSAAKVAVLMSVIMGPETADLPADMTSPSPQAARVRMSLREFLDDAKAATKPDQIVAIGHYLAIHESKDTF… |
| A0A0P1ERZ9 | 71-227 | None |
| Q2IIY6 | 3-143 | None |
| A0A481PJG2 | 289-431 | None |
| A0A1F8DT03 | 1-198 | None |
| A0A848TGT9 | 2-136 | None |
| A0A7W0SKR5 | 7-170 | None |
| A0A0P7WVT6 | 174-328 | None |
| A0A7C3SRE6 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.