DPCstruct | MC3662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 103 ± 1 aa |
| Standard deviation of domain lengths | 1.41 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 90.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10002 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A327L630 | 1-105 | MTDATAPVDRRFPVAAGIFFGLGLGGFFDGIVLHQVLQWHHMVSSHYPPDSVDNLRRNTLWDGLFHSTTYVFVVVGLILLWRSAHRR… |
| A0A2L0AAG0 | 1-102 | MLRANLSVLPLRWPIILGMAFSGFFDGILLHQLLQWHHFLSLATGPAMQDIRTQILGDGLFHVAVYMLTVAGLYGLWRHRSVVSGPG… |
| A0A4Q3T5Q1 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.