DPCstruct | MC36615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 390 ± 44 aa |
| Standard deviation of domain lengths | 43.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A2I8A2 | 8-379 | YGAPPFSNRAPDGEPPAADPPPQGTAGGTPPLRDDPRAAPYPEDEVLTEWFSDCATIGGTDHGVIIDYGRALRRFSGFLSQNGLPAL… |
| A0A839MDC6 | 74-481 | MADAGEVAAAPQGRSRGFKSRMVSGFKKAFGLSSGKTSSRGSGQQDVDAATETHVVSTKVRVDYAKRGRPADRDMHPDDESRINQFA… |
| A0A650F6V2 | 1-384 | None |
| A0A1C3XJH2 | 3-358 | None |
| A0A1R1QPE3 | 19-326 | None |
| A0A1Y6HSE4 | 1-479 | None |
| A0A7R7BYD3 | 125-537 | None |
| A0A7R6Z6S6 | 125-525 | None |
| A0A850I7J6 | 1-423 | None |
| A0A330JYR5 | 31-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.