DPCstruct | MC36613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 71 ± 2 aa |
| Standard deviation of domain lengths | 1.56 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 60.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482UEU3 | 51-120 | MKALLRSGDTEKIIFFAGMARSVDAYILAANYLTTQEWHAKADIMKSIVEFYSKAKAWEQLANFFTTAAG |
| A0A1S3JXW3 | 167-236 | MKALLKSGDTERIVFFAGVSRQKEIYVMAANYLQSLDWRKDPEIMKNIIGFYTKGRALDLLAGFYDACAQ |
| A0A8B6CC91 | 286-355 | None |
| A0A7S1JK20 | 729-798 | None |
| A0A7R9DYU4 | 9-78 | None |
| A0A3P7ECM9 | 1-70 | None |
| A0A2R6WWR5 | 769-838 | None |
| A0A388KSG2 | 611-680 | None |
| A0A0N4TES3 | 1-74 | None |
| A0A139ARL8 | 937-1008 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.