DPCstruct | MC36611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 205 ± 31 aa |
| Standard deviation of domain lengths | 31.32 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 17.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800F1P7 | 20-217 | SRSRYVPPQPAIKPVKTQNSSKLNTNSKSYQEKDIIRVLLDFGDKMIDEELSVSQYIFNQLEDASFEDDIHAAFLDDFRQVMLNKTM… |
| A0A849SQS5 | 1-150 | AVVTASRPHGRPAAERALERRLVTALLMEPDTFDAAAQRVAPEDFSETDLRGLAERLWTAPETLYTDEATGALARELVAAAESDMNW… |
| A0A6A5KX40 | 380-577 | None |
| A0A7X7H7Y7 | 6-220 | None |
| A0A3C1ZRL3 | 1-227 | None |
| A0A3C0U6A1 | 5-176 | None |
| A0A090WH81 | 49-234 | None |
| A0A645BIH9 | 1-180 | None |
| A0A660LNJ3 | 8-245 | None |
| A0A3D0FM50 | 196-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.