DPCstruct | MC3661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 257 ± 33 aa |
| Standard deviation of domain lengths | 32.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3RSA8 | 4-196 | NRQNERLLVASEARASRLSPEALRFLATSEYLGKQLLPEPDLEWSPVIIGLCKAAEVEIVNRLIRPLAQQTVSLDLKDDREDKDIGR… |
| A0A7Z8WAK7 | 19-293 | LDVQGVNLDGINQEVEGLQGYRKRMEEKIDNIGKKLSDLLINFDELKTETRGFEEKIVLMNLKLERIEQHIDAEDLEDYYLLSQSNY… |
| A0A402A664 | 484-748 | None |
| A0A5Q2MH14 | 177-383 | None |
| C4V1E9 | 290-564 | None |
| A0A1I1K7G8 | 208-474 | None |
| J1FE70 | 327-576 | None |
| A0A7X8FD61 | 121-367 | None |
| A0A0U3CXA7 | 385-639 | None |
| A0A1G4PQR5 | 303-612 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.