DPCstruct | MC36605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 411 |
|---|---|
| Mean domain length (aa) | 200 ± 39 aa |
| Standard deviation of domain lengths | 38.73 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03457 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419GY01 | 26-200 | SWQSNQRYYYKNSKLDTERIKRLEEIGFIWSEKRKFMLKPWDFWYGLTLICKEHTSNANAPHDYKTPEGFYLGRWQSNQRKNYKKNV… |
| A0A4D4MEH4 | 25-230 | TYQGAKVGIWLKNARTAARKAAEIERRRAEGLPVESSAGALSDERREQLEEIDASWCPSWPVTWQRCFHLVRMHLDAGEALPTTAGE… |
| K3WXX8 | 79-307 | None |
| A0A2E5FLY7 | 113-296 | None |
| A0A7S2AY41 | 51-228 | None |
| A0A1V9YD61 | 121-322 | None |
| A0A1V9YBX9 | 177-461 | None |
| A0A1V9YBZ6 | 39-278 | None |
| A0A1V9YCY7 | 504-733 | None |
| A0A067C549 | 275-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.