DPCstruct | MC36603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 207 ± 39 aa |
| Standard deviation of domain lengths | 38.84 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.92 |
| Pfam Score | 62.22 |
| Assigned Pfam label(s) | CL0264- CL0103- PF09335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0X3NZT6 | 1-256 | MTSKKQPKKSAASRQIEAEQNERKNLKILRSPLKTSILFLRECLYQFSCLASNLYRHKISGLLTTLIILGLFVLRNVDGSHQAFFMF… |
| A0A1D6MNF0 | 16-172 | VTLVLSLMQHLQELLWYVRFGLWWIILGVASSIGLGSGLHTFIMYLAPHVALFTIKAVQCGRVDLKSAPYDTILLERRPSWLEKDCL… |
| L9KGH7 | 74-235 | None |
| A0A6V7TWG5 | 74-311 | None |
| H9JTU1 | 2-133 | None |
| I3S058 | 3-176 | None |
| A0A1Y1VH86 | 45-263 | None |
| A0A1B6LC91 | 9-246 | None |
| G0QQT6 | 2-186 | None |
| A0A5N3WM96 | 18-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.