DPCstruct | MC36602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 6.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0X3NWU4 | 1-68 | MESYFVNQRENIFRNVEVLIYVFDVESQEVNKDLAYYRSCLEAISQHSPDAKIFCLIHKMDLISEERR |
| A0A6J3QTP2 | 145-225 | ENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRL |
| A0A3P3YF44 | 62-128 | None |
| A0A662XX44 | 107-192 | None |
| A0A813ZD54 | 266-345 | None |
| A0A1V2LH48 | 16-91 | None |
| A0A3Q0JBZ3 | 1-70 | None |
| A0A5J4NLU1 | 29-95 | None |
| A0A7J7XD62 | 48-133 | None |
| W7IEH8 | 68-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.