DPCstruct | MC36601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 146 ± 25 aa |
| Standard deviation of domain lengths | 24.88 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.41 |
| Pfam Score | 99.49 |
| Assigned Pfam label(s) | CL0123- PF00137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0X3NPC2 | 8-138 | YFIACGAAYGTARSSMGISCMAVRKPELIMKSLVPIVMAGIIAVYGLVVSVLIAGQVSVDYTLQQSLSHFGAGLSVGLSGLAAGYAI… |
| A0A0U3FW37 | 4-153 | GLALAIFGAAIAAGLAGIGSAKGVQISGEAAAGVVAERPEMFGKMLVLQALPGTQGIYGFLTAVLIMVQIGILGGTPLDLSLYQGMS… |
| A0A366R651 | 13-144 | None |
| A0A396H5I4 | 102-265 | None |
| A0A662MGV3 | 90-243 | None |
| A0A653BR05 | 11-166 | None |
| A0A6A6GMC6 | 32-195 | None |
| A0A6A3NFK3 | 10-120 | None |
| A0A7C1CI15 | 1-175 | None |
| A0A5C3L3T2 | 12-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.