DPCstruct | MC36600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 302 ± 45 aa |
| Standard deviation of domain lengths | 44.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 17.50 |
| Pfam Score | 76.98 |
| Assigned Pfam label(s) | PF12660- PF19336- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0J7Z2 | 46-321 | AELVNFLMRSGDKPLRGQLDSIQELHRRLLATEPAAKVTSANDMDSFILRPFNYLLDQLLSDENTDYSRMSLEKLQIQRAEFSLFLR… |
| A0A137Q4S7 | 880-1157 | PLFLLRPYLFHFTNRSRLNELHTQILSILDIPPDTEDYSLLIEIPPCPDTTLLDSGVRKRFRDSVTRHLFGYDALLRLRLRLSVADF… |
| A0A059B867 | 65-395 | None |
| A0A813X8K4 | 246-574 | None |
| R7QIM2 | 144-474 | None |
| A0A6A3B4Z2 | 438-767 | None |
| A0A0S6XKY6 | 373-628 | None |
| A0A177WP49 | 397-668 | None |
| A0A2P2MFC5 | 313-661 | None |
| A0A0A9VC37 | 1-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.