DPCstruct | MC366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 161 ± 19 aa |
| Standard deviation of domain lengths | 18.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08497- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E5AEZ9 | 220-404 | DIILHSHEECLHNKKGQAENVRHLEEEANKMHAQRMIQEVDGKYVVVNPPFPLMTTAELDAAFDLPYTRLPHPKYKGKTIPAYEMIK… |
| A0A7Z1A3F5 | 18-185 | NRILHLETNPGNARALVQRHGDRDVWLNPPALPLSTEELDAVFDLPYTRLPHPSYGDARFPAFDMIKFSVNIMRDCFGGCTFCSITE… |
| A0A6N6JQD3 | 472-647 | None |
| R5GXT8 | 78-243 | None |
| A0A7V4GFF6 | 410-568 | None |
| T0D1V9 | 62-228 | None |
| A0A3S4JVZ8 | 3-146 | None |
| A0A7C1EQE6 | 222-414 | None |
| A0A357XUJ5 | 1-178 | None |
| A0A1Y0FZB2 | 360-524 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.