DPCstruct | MC36598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 222 ± 40 aa |
| Standard deviation of domain lengths | 39.64 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.82 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09736 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0J2Z8 | 40-239 | LDAFDERTKMEFNLFPSATPSLTGEVLNEFMLPTNVRKRKTTSLLDAEAQADKARKQAELEAKYALWNRGIETVKERDEELQAELYE… |
| A0A7S2R324 | 7-149 | AELQNKEEQQRRQNLEKQQQSLELNLGKAQKQAIRSRLANMEAMEHVGLAQTQTEVDSWQKDVIRNGDPMAATALKKAAAAAAGGKG… |
| A0A2K5QBH1 | 367-606 | None |
| A0A5J4Z084 | 56-212 | None |
| A0A7J6KXN4 | 452-668 | None |
| K3WLA6 | 451-699 | None |
| A0A2T6ZRU1 | 61-252 | None |
| A0A154P8E6 | 256-570 | None |
| A0A2G3CL87 | 263-505 | None |
| A0A2A2KN29 | 839-1071 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.