DPCstruct | MC36595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 322 |
|---|---|
| Mean domain length (aa) | 127 ± 34 aa |
| Standard deviation of domain lengths | 34.22 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 87.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.41 |
| Pfam Score | 68.52 |
| Assigned Pfam label(s) | CL0649- CL0668- CL0588- CL0271- PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E6RDN1 | 118-248 | EALGLTKCHDRISIFTIHSVPIFFQHFDGPFIPTLKLLHMYPDMLPHVQIDRGAIKFLLAGANMMAPGLLSAGGKLPDGMEKDTIVA… |
| A0A843MCT0 | 80-221 | AIADYQFGVGVGDALFTGNIKIEKSKKTGKIRHIYDGKTLIVNMRASDSFLILSKEGAKRLHAATQYPKNRVVVNKDSEPFSLEGKS… |
| A0A0B3ABW9 | 811-893 | None |
| A0A654GRI8 | 2-81 | None |
| A0A662UVF1 | 21-178 | None |
| A0A2I3M5T2 | 9-159 | None |
| A0A6A5E1Z7 | 303-388 | None |
| A0A6A5D9X3 | 25-197 | None |
| A0A6V8H002 | 21-179 | None |
| A0A0F4Z0C3 | 58-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.