DPCstruct | MC3659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 425 ± 63 aa |
| Standard deviation of domain lengths | 62.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20129 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7UK69 | 1-378 | MKGDFSRLLFAPRKHYSSVRLQQGRVTLDRDWNEQASIREQHERTVFEELVGACGSPSAGGFALIREGTTLHVTAGRSYVGGFCCEL… |
| A0A7T0BWU2 | 1-417 | MSGDYSRLTYDPVKRYSGVLMQQGRVQLDSDWNEEIDILRRRIRTLSTDALGLIGVPYLSLPDSFLLGLIGGPPADDLSIEPGRLYL… |
| A0A6I5X2Z5 | 1-290 | None |
| A0A521DYK0 | 1-477 | None |
| A0A6N8FQ14 | 7-561 | None |
| A0A4Q5X5J4 | 1-503 | None |
| A0A3R9XVB5 | 346-710 | None |
| A0A3E1NG57 | 1-462 | None |
| A0A428MCM8 | 1-484 | None |
| A0A238LBA9 | 14-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.